PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011074366.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 135aa    MW: 14038 Da    PI: 9.5305
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011074366.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26044.44.9e-142554497
          DUF260 44 kllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                    ++++a+pe++r+++++sl++eA+ r+ +Pv+Gavg++++++++++q+++e++l+
  XP_011074366.1  2 SFIAAVPETKRPALFQSLLFEACGRTVNPVNGAVGLLSTGNWHICQAAVETVLA 55
                    68999********************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.619159IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-10253IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MSFIAAVPET KRPALFQSLL FEACGRTVNP VNGAVGLLST GNWHICQAAV ETVLAGGVLR  60
PISVGIVAPN SDEASGWGNN QSTSKHKGVV HGSMGGSRNC MEKTASFGSG ISEVSRENRV  120
KGVGSKEPKL LNLFA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074366.11e-94PREDICTED: LOB domain-containing protein 37-like
SwissprotQ9SZE87e-34LBD39_ARATH; LOB domain-containing protein 39
TrEMBLA0A068TYW98e-41A0A068TYW9_COFCA; Uncharacterized protein
STRINGVIT_18s0001g09250.t015e-35(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37540.14e-35LOB domain-containing protein 39